PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G069300.1
Common NamePHAVU_009G069300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 272aa    MW: 31002 Da    PI: 7.8758
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G069300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.84.3e-26953145
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        k+ien++nrqvtfskRrng++KKA+ELSvLC+++va+i+fs++g+
  Phvul.009G069300.1  9 KKIENTTNRQVTFSKRRNGLIKKAYELSVLCGVDVALIMFSPSGR 53
                        68****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.7E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.217161IPR002100Transcription factor, MADS-box
CDDcd002651.25E-38278No hitNo description
SuperFamilySSF554559.29E-30281IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-23323IPR002100Transcription factor, MADS-box
PfamPF003195.5E-261055IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-233859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGRVKLQIKK IENTTNRQVT FSKRRNGLIK KAYELSVLCG VDVALIMFSP SGRPSFFSGN  60
KSIEEILERY VNLQSGEHGS TFRSCLEVRR EIFTCKSQLK EMEERLRIFE GDPSEITTLR  120
EAEYREYVLR QTLKQVQLRK CVLEENNSEA SHSPQVHGAK SVDVNNFVTS ASKNPVDWFP  180
HGNPHARTLN FENVYDPAPT RDQQPHSIAG VLTPTSRLVY SANMHQNDEM NPRNSLDVGI  240
NNTILCPQFE QTTLMNSSSW EHLHPLGTYW C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-15170169Myocyte-specific enhancer factor 2B
1tqe_R2e-15170169Myocyte-specific enhancer factor 2B
1tqe_Q2e-15170169Myocyte-specific enhancer factor 2B
1tqe_P2e-15170169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136729.10.0hypothetical protein PHAVU_009G069300g
SwissprotQ9LM462e-38AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLV7AVU20.0V7AVU2_PHAVU; Uncharacterized protein
STRINGGLYMA04G04641.11e-140(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF136651922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.11e-30AGAMOUS-like 104